ZNF185 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "ZNF185"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF185 antibody: synthetic peptide directed towards the N terminal of human ZNF185. Synthetic peptide located within the following region: LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 73 kDa |
Gene Name | zinc finger protein 185 (LIM domain) |
Database Link | |
Background | ZNF185 contains 1 LIM zinc-binding domain. The function of ZNF185 remains unknown.ZNF185 encodes a LIM-domain zinc finger protein. These proteins are thought to be involved in protein-protein interactions. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1276 AY997296.1 1-1276 1277-4307 AK056517.1 347-3377 4308-4312 BQ923456.1 628-632 |
Synonyms | SCELL |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.