Rabbit Polyclonal Anti-ZNF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF19 antibody: synthetic peptide directed towards the N terminal of human ZNF19. Synthetic peptide located within the following region: TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE |
Rabbit Polyclonal Anti-ZNF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF19 antibody: synthetic peptide directed towards the C terminal of human ZNF19. Synthetic peptide located within the following region: HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP |
ZNF19 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF19 |
ZNF19 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ZNF19 (NP_008892.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
