ZNF19 Rabbit Polyclonal Antibody

CAT#: TA346445

Rabbit Polyclonal Anti-ZNF19 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ZNF19"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF19 antibody: synthetic peptide directed towards the N terminal of human ZNF19. Synthetic peptide located within the following region: TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name zinc finger protein 19
Background ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.
Synonyms KOX12
Note Immunogen Sequence Homology: Human: 100%; Horse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.