Rabbit Polyclonal Anti-ZNF205 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF205 antibody: synthetic peptide directed towards the N terminal of human ZNF205. Synthetic peptide located within the following region: PSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGS |
Rabbit Polyclonal Anti-ZNF205 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF205 antibody: synthetic peptide directed towards the middle region of human ZNF205. Synthetic peptide located within the following region: PYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPA |
ZNF205 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZN205 |
Germany
Japan
United Kingdom
China