ZNF205 Rabbit Polyclonal Antibody

CAT#: TA343409

Rabbit Polyclonal Anti-ZNF205 Antibody

Product Images

WB Suggested Anti-ZNF205 Antibody Titration: 5.0 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF205 antibody: synthetic peptide directed towards the N terminal of human ZNF205. Synthetic peptide located within the following region: PSKLGEAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGAWGWAPLSHGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: zinc finger protein 205
• Database Link:
  NP_003447
  Entrez Gene 7755 Human
  UniProt ID O95201
• Background: ZNF205 may be involved in transcriptional regulation.
• Synonyms: RhitH; Zfp13; ZNF210
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 86%; Bovine: 85%; Dog: 79%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors