Antibodies

Jump to Filters
View as table Download
ZNF212 Rabbit Polyclonal Antibody
TA333882

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF212 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF212 Antibody: synthetic peptide directed towards the N terminal of human ZNF212. Synthetic peptide located within the following region: RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEA
ZNF212 Rabbit Polyclonal Antibody
TA333881

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZNF212 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF212 Antibody: synthetic peptide directed towards the C terminal of human ZNF212. Synthetic peptide located within the following region: EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV