ZNF212 Rabbit Polyclonal Antibody

CAT#: TA333881

Rabbit Polyclonal Anti-ZNF212 Antibody

Product Images

WB Suggested Anti-ZNF212 Antibody Titration: 1.25 ug/ml; Positive Control: K562 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF212 Antibody: synthetic peptide directed towards the C terminal of human ZNF212. Synthetic peptide located within the following region: EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: zinc finger protein 212
• Database Link:
  NP_036388
  Entrez Gene 7988 Human
  UniProt ID Q9UDV6
• Background: ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.
• Synonyms: C2H2-150; ZNF182; ZNFC150
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Dog: 90%; Horse: 86%; Rabbit: 85%; Rat: 83%; Mouse: 83%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors