Rabbit Polyclonal Anti-ZNF226 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF226 Antibody: synthetic peptide directed towards the N terminal of human ZNF226. Synthetic peptide located within the following region: ATRRQGNLGEKNQSKLITVQDRESEEELSCWQIWQQIANDLTRCQDSMIN |
Rabbit Polyclonal Anti-ZNF226 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the middle region of human ZNF226. Synthetic peptide located within the following region: KGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGQK |
Rabbit Polyclonal Anti-ZNF226 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the C terminal of human ZNF226. Synthetic peptide located within the following region: KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPY |
Rabbit Polyclonal Anti-ZNF226 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the middle region of human ZNF226. Synthetic peptide located within the following region: ACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGE |
Carrier-free (BSA/glycerol-free) ZNF226 mouse monoclonal antibody,clone OTI11E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF226 mouse monoclonal antibody,clone OTI8G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF226 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF226 mouse monoclonal antibody,clone OTI11E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF226 mouse monoclonal antibody,clone OTI11E9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF226 mouse monoclonal antibody,clone OTI11E9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF226 mouse monoclonal antibody,clone OTI11E9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF226 mouse monoclonal antibody,clone OTI8G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF226 mouse monoclonal antibody,clone OTI8G4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF226 mouse monoclonal antibody,clone OTI8G4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF226 mouse monoclonal antibody,clone OTI8G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF226 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF226 mouse monoclonal antibody,clone OTI4E1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF226 mouse monoclonal antibody,clone OTI4E1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF226 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China