ZNF226 Rabbit Polyclonal Antibody

CAT#: TA339652

Rabbit Polyclonal Anti-ZNF226 Antibody

Product Images

WB Suggested Anti-ZNF226 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF226 antibody: synthetic peptide directed towards the C terminal of human ZNF226. Synthetic peptide located within the following region: KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: zinc finger protein 226
• Database Link:
  NP_001027544
  Entrez Gene 7769 Human
  UniProt ID Q9NYT6
• Background: ZNF226 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF226 may be involved in transcriptional regulation.
• Synonyms: Kruppel-associated box protein; zinc finger protein 226
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 85%

Reference Data

• Protein Families: Transcription Factors