Antibodies

Jump to Filters
View as table Download
Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody
TA315655

USD 345.00

In Stock

Rabbit polyclonal anti-ZNF287 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF287.
Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody
TA345291

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF287 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF287 antibody: synthetic peptide directed towards the N terminal of human ZNF287. Synthetic peptide located within the following region: LASSKRMNSSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQN
Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody
TA347739

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ZNF287 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF287 Antibody: A synthesized peptide derived from human ZNF287
Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody
TA324645

USD 450.00

5 Days

Rabbit polyclonal ZNF287 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ZNF287 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 124-150 amino acids from the N-terminal region of human ZNF287.