Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 287 (ZNF287)
USD 605.00
Other products for "ZNF287"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF287 antibody: synthetic peptide directed towards the N terminal of human ZNF287. Synthetic peptide located within the following region: LASSKRMNSSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 87 kDa |
Gene Name | zinc finger protein 287 |
Database Link | |
Background | ZNF287 is a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene encodes a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene is located near the Smith-Magenis syndrome region on chromosome 17. |
Synonyms | ZKSCAN13; ZSCAN45 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 85%; Rat: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.