Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody

CAT#: TA345291

Rabbit Polyclonal Anti-ZNF287 Antibody

Product Images

WB Suggested Anti-ZNF287 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF287 antibody: synthetic peptide directed towards the N terminal of human ZNF287. Synthetic peptide located within the following region: LASSKRMNSSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: zinc finger protein 287
• Database Link:
  NP_065704
  Entrez Gene 57336 Human
  UniProt ID Q9HBT7
• Background: ZNF287 is a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene encodes a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene is located near the Smith-Magenis syndrome region on chromosome 17.
• Synonyms: ZKSCAN13; ZSCAN45
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 85%; Rat: 79%

Reference Data

• Protein Families: Transcription Factors