Rabbit Polyclonal Anti-ZNF330 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF330 Antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF330. Synthetic peptide located within the following region: DLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHDEEEDE |
Carrier-free (BSA/glycerol-free) ZNF330 mouse monoclonal antibody,clone OTI8E9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZNF330 mouse monoclonal antibody,clone OTI8E9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF330 mouse monoclonal antibody,clone OTI8E9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZNF330 mouse monoclonal antibody,clone OTI8E9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZNF330 mouse monoclonal antibody,clone OTI8E9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China