ZNF330 Rabbit Polyclonal Antibody

CAT#: TA331978

Rabbit Polyclonal Anti-ZNF330 Antibody

Product Images

Host: Rabbit; Target Name: ZNF330; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF330 Antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF330. Synthetic peptide located within the following region: DLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHDEEEDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: zinc finger protein 330
• Database Link:
  NP_055302
  Entrez Gene 27309 Human
  UniProt ID Q9Y3S2
• Background: The function of this protein remains unknown.
• Synonyms: HSA6591; NOA36
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 79%