Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF41 antibody: synthetic peptide directed towards the C terminal of human ZNF41. Synthetic peptide located within the following region: LRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKT

ZNF41 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF41

ZNF41 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF41