ZNF41 Rabbit Polyclonal Antibody

CAT#: TA342506

Rabbit Polyclonal Anti-ZNF41 Antibody

Product Images

WB Suggested Anti-ZNF41 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF41 antibody: synthetic peptide directed towards the C terminal of human ZNF41. Synthetic peptide located within the following region: LRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: zinc finger protein 41
• Database Link:
  NP_700359
  Entrez Gene 7592 Human
  UniProt ID P51814
• Background: This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known. [provided by RefSeq, Jul 2008]
• Synonyms: MRX89
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors