Rabbit Polyclonal Anti-ZNF419 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419. Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL |
Rabbit Polyclonal Anti-ZNF419A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF419A antibody: synthetic peptide directed towards the C terminal of human ZNF419A. Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ |
Rabbit Polyclonal Anti-ZNF419 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419. Synthetic peptide located within the following region: MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRL |
Rabbit Polyclonal Anti-ZNF419 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419. Synthetic peptide located within the following region: AEEAPEQIASVGLLSSNIQQHQKQHCGEKPLKRQEGRVPVLRSCKVHLSE |
Germany
Japan
United Kingdom
China
