ZNF419A (ZNF419) Rabbit Polyclonal Antibody

CAT#: TA345395

Rabbit Polyclonal Anti-ZNF419A Antibody

Product Images

WB Suggested Anti-ZNF419A Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF419A antibody: synthetic peptide directed towards the C terminal of human ZNF419A. Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: zinc finger protein 419
• Database Link:
  NP_078967
  Entrez Gene 79744 Human
  UniProt ID Q96HQ0
• Background: ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF419A may be involved in transcriptional regulation.
• Synonyms: ZAPHIR; ZNF419A
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Rabbit: 92%; Mouse: 91%; Dog: 86%; Horse: 86%; Pig: 85%; Rat: 83%; Sheep: 77%

Reference Data

• Protein Families: Transcription Factors