Rabbit Polyclonal Anti-ZNF551 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF551 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF551. Synthetic peptide located within the following region: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA |
Rabbit Polyclonal Anti-ZNF551 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF551 antibody: synthetic peptide directed towards the N terminal of human ZNF551. Synthetic peptide located within the following region: FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN |
ZNF551 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-250 of human ZNF551 (NP_612356.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
