ZNF551 Rabbit Polyclonal Antibody

CAT#: TA341447

Rabbit Polyclonal Anti-ZNF551 Antibody

Product Images

WB Suggested Anti-ZNF551 Antibody Titration: 0.6 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysateZNF551 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF551 antibody: synthetic peptide directed towards the N terminal of human ZNF551. Synthetic peptide located within the following region: FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: zinc finger protein 551
• Database Link:
  NP_612356
  Entrez Gene 90233 Human
  UniProt ID Q7Z340
• Background: May be involved in transcriptional regulation.
• Synonyms: DKFZp686H1038; MGC52307
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors