Antibodies

Jump to Filters
View as table Download
ZNF558 Rabbit Polyclonal Antibody
TA345510

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF558 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF558 antibody: synthetic peptide directed towards the N terminal of human ZNF558. Synthetic peptide located within the following region: AAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWAL
ZNF558 Rabbit Polyclonal Antibody
TA337903

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF558 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF558 antibody: synthetic peptide directed towards the N terminal of human ZNF558. Synthetic peptide located within the following region: GILPSTCPDLETLLKAKWLTPKKNVFRKEQSKGVKTERSHRGVKLNECNQ
ZNF558 Mouse Monoclonal Antibody [Clone ID: OTI2C4]
CF811169

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF558 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ZNF558 Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA811169

USD 379.00

In Stock

ZNF558 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ZNF558 Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA811169S

USD 159.00

2 Days

ZNF558 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated