ZNF558 Rabbit Polyclonal Antibody

CAT#: TA345510

Rabbit Polyclonal Anti-ZNF558 Antibody

Product Images

WB Suggested Anti-ZNF558 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF558 antibody: synthetic peptide directed towards the N terminal of human ZNF558. Synthetic peptide located within the following region: AAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: zinc finger protein 558
• Database Link:
  NP_653294
  Entrez Gene 148156 Human
  UniProt ID Q96NG5
• Background: ZNF588 contains 1 KRAB domain and 9 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Synonyms: FLJ30932
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors