Antibodies

Jump to Filters
View as table Download
ZNF572 Rabbit Polyclonal Antibody
TA345542

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF572 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF572 antibody: synthetic peptide directed towards the N terminal of human ZNF572. Synthetic peptide located within the following region: HHNNSKADKLKEKPSEWSKRHRPQHYKHEDAKEMPLTWVQDEIWCHDSYE
ZNF572 Rabbit Polyclonal Antibody
TA345543

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZNF572 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF572 antibody: synthetic peptide directed towards the middle region of human ZNF572. Synthetic peptide located within the following region: PYKCTSCEKCFSRSAYLSQHRKIHVEKPFESPDVGDFPHEWTWKNCSGEM
ZNF572 (C-term) Rabbit Polyclonal Antibody
AP54664PU-N

USD 450.00

2 Weeks

ZNF572 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human ZN572
ZNF572 Rabbit Polyclonal Antibody
TA341479

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF572 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF572 antibody: synthetic peptide directed towards the middle region of human ZNF572. Synthetic peptide located within the following region: YKCTSCEKCFSRSAYLSQHRKIHVEKPFESPDVGDFPHEWTWKNCSGEMP
ZNF572 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF811667

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF572 mouse monoclonal antibody,clone OTI2F6

Applications WB
Reactivities Human
Conjugation Unconjugated
ZNF572 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
CF811673

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZNF572 mouse monoclonal antibody,clone OTI1A6

Applications WB
Reactivities Human
Conjugation Unconjugated
ZNF572 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA811667

USD 379.00

In Stock

ZNF572 mouse monoclonal antibody,clone OTI2F6

Applications WB
Reactivities Human
Conjugation Unconjugated
ZNF572 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA811667S

USD 159.00

2 Days

ZNF572 mouse monoclonal antibody,clone OTI2F6

Applications WB
Reactivities Human
Conjugation Unconjugated
ZNF572 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
TA811673

USD 379.00

In Stock

ZNF572 mouse monoclonal antibody,clone OTI1A6

Applications WB
Reactivities Human
Conjugation Unconjugated
ZNF572 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]
TA811673BM

USD 420.00

4 Weeks

ZNF572 mouse monoclonal antibody,clone OTI1A6, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP
ZNF572 Mouse Monoclonal Antibody [Clone ID: OTI1A6]
TA811673S

USD 159.00

2 Days

ZNF572 mouse monoclonal antibody,clone OTI1A6

Applications WB
Reactivities Human
Conjugation Unconjugated