Germany
Japan
United Kingdom
China
ZNF572 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 572 (ZNF572)
USD 605.00
Other products for "ZNF572"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF572 antibody: synthetic peptide directed towards the middle region of human ZNF572. Synthetic peptide located within the following region: PYKCTSCEKCFSRSAYLSQHRKIHVEKPFESPDVGDFPHEWTWKNCSGEM |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 61 kDa |
| Gene Name | zinc finger protein 572 |
| Database Link | |
| Background | ZNF572 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
| Synonyms | FLJ38002 |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Rat: 77%; Horse: 77% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.