Antibodies

View as table Download

Rabbit Polyclonal Anti-ZNF8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF8 antibody: synthetic peptide directed towards the N terminal of human ZNF8. Synthetic peptide located within the following region: MDPEDEGVAGVMSVGPPAARLQEPVTFRDVAVDFTQEEWGQLDPTQRILY

ZNF8 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF8

Rabbit Polyclonal Anti-ZNF8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF8 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF8. Synthetic peptide located within the following region: AVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQG

Rabbit Polyclonal Anti-ZNF8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF8 Antibody: synthetic peptide directed towards the N terminal of human ZNF8. Synthetic peptide located within the following region: TQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGTELW

Carrier-free (BSA/glycerol-free) ZNF8 mouse monoclonal antibody,clone OTI2B6

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF8 mouse monoclonal antibody,clone OTI3D2

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF8 mouse monoclonal antibody,clone OTI3E5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZNF8 mouse monoclonal antibody,clone OTI5G1

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF8

ZNF8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF8

ZNF8 mouse monoclonal antibody,clone OTI2B6

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI2B6, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ZNF8 mouse monoclonal antibody,clone OTI2B6

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI3D2

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI3D2, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ZNF8 mouse monoclonal antibody,clone OTI3D2

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI3E5

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI3E5, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ZNF8 mouse monoclonal antibody,clone OTI3E5

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI5G1

Applications WB
Reactivities Human
Conjugation Unconjugated

ZNF8 mouse monoclonal antibody,clone OTI5G1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

ZNF8 mouse monoclonal antibody,clone OTI5G1

Applications WB
Reactivities Human
Conjugation Unconjugated