ZNF8 Rabbit Polyclonal Antibody

CAT#: TA343398

Rabbit Polyclonal Anti-ZNF8 Antibody

Product Images

Host: Rabbit; Target Name: ZNF8; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF8 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF8. Synthetic peptide located within the following region: AVDFTQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: zinc finger protein 8
• Database Link:
  NP_066575
  Entrez Gene 7554 Human
  UniProt ID P17098
• Background: ZNF8 may be involved in transcriptional regulation.
• Synonyms: HF.18; Zfp128
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rat: 85%; Mouse: 85%; Rabbit: 83%