Rabbit Polyclonal Anti-HKR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the C terminal of human HKR1. Synthetic peptide located within the following region: RECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG |
Rabbit Polyclonal Anti-HKR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the N terminal of human HKR1. Synthetic peptide located within the following region: RDVAVYFTQEEWRLLSPAQRTLHREVMLETYNHLVSLEIPSSKPKLIAQL |
Rabbit Polyclonal Anti-HKR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the N terminal of human HKR1. Synthetic peptide located within the following region: GTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVS |
Rabbit Polyclonal Anti-HKR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HKR1 antibody is: synthetic peptide directed towards the C-terminal region of Human HKR1. Synthetic peptide located within the following region: LIKHQRAHAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRG |
Germany
Japan
United Kingdom
China
