ZNF875 Rabbit Polyclonal Antibody

CAT#: TA345616

Rabbit Polyclonal Anti-HKR1 Antibody

Product Images

WB Suggested Anti-HKR1 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

• 

  Human Heart

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the C terminal of human HKR1. Synthetic peptide located within the following region: RECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: HKR1, GLI-Kruppel zinc finger family member
• Database Link:
  NP_861451
  Entrez Gene 284459 Human
  UniProt ID P10072
• Background: HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-terminal histidine of one finger to the N-terminal cysteine of the next. On the basis of amino acid sequence and intron-exon organization, the genes could be placed into one of two subgroups: the GLI subgroup (with the consensus finger amino acid sequence [Y/F]XCX3GCX3[F/Y]X5LX2HX3-4H[T/S]GEKP) or the Kr subgroup (with the consensus finger amino acid sequence [Y/F]XCX2CX3FX5LX2HXRXHTGEKP).
• Synonyms: ZNF875
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 92%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors