Rabbit Polyclonal Anti-ZNF31 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF31 antibody: synthetic peptide directed towards the N terminal of human ZNF31. Synthetic peptide located within the following region: MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEAS |
Rabbit Polyclonal Anti-ZSCAN20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZSCAN20 Antibody: synthetic peptide directed towards the middle region of human ZSCAN20. Synthetic peptide located within the following region: QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSSHFIAHQRIHTGE |
ZSCAN20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ZSCAN20 (NP_660281.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China