ZNF31 (ZSCAN20) Rabbit Polyclonal Antibody

CAT#: TA345521

Rabbit Polyclonal Anti-ZNF31 Antibody

Product Images

WB Suggested Anti-ZNF31 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF31 antibody: synthetic peptide directed towards the N terminal of human ZNF31. Synthetic peptide located within the following region: MAMALELQAQASPQPEPEELLIVKLEEDSWGSESKLWEKDRGSVSGPEAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: zinc finger and SCAN domain containing 20
• Database Link:
  NP_660281
  Entrez Gene 7579 Human
  UniProt ID P17040
• Background: ZNF31contains 1 KRAB domain and 10 C2H2-type zinc fingers. ZNF31 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Synonyms: KOX29; ZFP-31; ZNF31; ZNF360
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 92%; Pig: 85%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors