ZBTB10 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ZBTB10 |
ZBTB10 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ZBTB10 |
ZBTB10 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 560-590 amino acids from the C-terminal region of human ZBTB10 |
Rabbit Polyclonal Anti-ZBTB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB10 Antibody: synthetic peptide directed towards the N terminal of human ZBTB10. Synthetic peptide located within the following region: SAWPPQPQPRQPPPPAPPALQPPNGRGADEEVELEGLEPQDLEASAGPAA |
Rabbit Polyclonal Anti-ZBTB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB10 antibody: synthetic peptide directed towards the middle region of human ZBTB10. Synthetic peptide located within the following region: GGQEGVDQGQDTEFPRDEEYEENEVGEADEELVDDGEDQNDPSRWDESGE |