ZBTB10 Rabbit Polyclonal Antibody

CAT#: TA341386

Rabbit Polyclonal Anti-ZBTB10 Antibody

Product Images

WB Suggested Anti-ZBTB10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateZBTB10 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB10 antibody: synthetic peptide directed towards the middle region of human ZBTB10. Synthetic peptide located within the following region: GGQEGVDQGQDTEFPRDEEYEENEVGEADEELVDDGEDQNDPSRWDESGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: zinc finger and BTB domain containing 10
• Database Link:
  NP_076418
  Entrez Gene 65986 Human
  UniProt ID Q96DT7
• Background: May be involved in transcriptional regulation.
• Synonyms: RINZF
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 85%; Bovine: 79%

Reference Data

• Protein Families: Transcription Factors