Rabbit Polyclonal ZBTB38 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB38 antibody: human ZBTB38 (zinc finger and BTB domain containing 38), using three KLH-conjugated synthetic peptides, two containing a sequence from the central part and one containing a sequence from the C-terminal part of the p |
ZBTB38 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 132-161 amino acids from the N-terminal region of human ZBTB38 |
Rabbit polyclonal anti-ZBTB38 antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-ZBTB38 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS |
Zbtb38 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
