Antibodies

Jump to Filters
View as table Download
ThPok Rabbit Polyclonal Antibody
TA331139

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZFP67 Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-ZFP67 antibody: synthetic peptide directed towards the middle region of human ZFP67. Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
ThPok (ZBTB7B) Rabbit Polyclonal Antibody
TA359918

USD 360.00

5 Days

ZBTB7B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZBT7B