ThPok Rabbit Polyclonal Antibody

CAT#: TA331139

Rabbit Polyclonal Anti-ZFP67 Antibody

Product Images

WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: ZFP67; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: ZFP67; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1.25ug/mL; Peptide Concentration: 1.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

• 

  Human Lung

• 

  Human Heart

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFP67 antibody: synthetic peptide directed towards the middle region of human ZFP67. Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Database Link:
  NP_056956
  Entrez Gene 51043 Human
• Background: ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes and has a role in development.
• Synonyms: c-Krox; DKFZp686G01254; hcKrox; THPOK; ZBTB15; ZFP67; ZNF857B
• Note: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors