Rabbit Polyclonal Anti-ZBTB8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB8B antibody is: synthetic peptide directed towards the C-terminal region of Human ZBTB8B. Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET |
ZBTB8B (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 449-478 amino acids from the C-terminal region of human ZBTB8B |
Rabbit Polyclonal anti-ZBTB8 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB8 antibody: synthetic peptide directed towards the c terminal of human ZBTB8. Synthetic peptide located within the following region: LSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDND |
Germany
Japan
United Kingdom
China