ZBTB8B Rabbit Polyclonal Antibody

CAT#: TA329329

Rabbit Polyclonal anti-ZBTB8 antibody

Product Images

WB Suggested Anti-ZBTB8 Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB8 antibody: synthetic peptide directed towards the c terminal of human ZBTB8. Synthetic peptide located within the following region: LSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDND
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger and BTB domain containing 8B
• Database Link:
  NP_001139192
  Entrez Gene 728116 Human
  UniProt ID Q8NAP8
• Background: ZBTB8 may be involved in transcriptional regulation.
• Synonyms: ZNF916B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Rabbit: 86%