Antibodies

Jump to Filters
View as table Download
ZC3H15 (C-term) Rabbit Polyclonal Antibody
AP54621PU-N

USD 450.00

2 Weeks

ZC3H15 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 370-399 amino acids from the C-terminal region of human ZC3H15
ZC3H15 Rabbit Polyclonal Antibody
TA339734

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZC3H15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZC3H15 antibody: synthetic peptide directed towards the middle region of human ZC3H15. Synthetic peptide located within the following region: SGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIP
ZC3H15 Rabbit Polyclonal Antibody
TA383450

USD 220.00

3 Weeks

ZC3H15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ZC3H15 (NP_060941.2).
Modifications Unmodified