ZC3H15 Rabbit Polyclonal Antibody

CAT#: TA339734

Rabbit Polyclonal Anti-ZC3H15 Antibody

Product Images

WB Suggested Anti-ZC3H15 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZC3H15 antibody: synthetic peptide directed towards the middle region of human ZC3H15. Synthetic peptide located within the following region: SGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: zinc finger CCCH-type containing 15
• Database Link:
  NP_060941
  Entrez Gene 55854 Human
  UniProt ID Q8WU90
• Background: ZC3H15 belongs to the ZC3H15/TMA46 family. It contains 2 C3H1-type zinc fingers. ZC3H15 protects DRG1 from proteolytic degradation.
• Synonyms: HT010; LEREPO4; MSTP012
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Yeast: 90%; Zebrafish: 85%