Germany
Japan
United Kingdom
China
ZCCHC24 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal Anti-C10orf56 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C10orf56 antibody: synthetic peptide directed towards the middle region of human C10orf56. Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL |
ZCCHC24 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZCCHC24 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ZCCHC24 mouse monoclonal antibody,clone 2E1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZCCHC24 mouse monoclonal antibody,clone 2E1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Active filters
Target Symbol
- ZCCHC24