ZCCHC24 Rabbit Polyclonal Antibody

CAT#: TA330941

Rabbit polyclonal Anti-C10orf56 Antibody

Product Images

WB Suggested Anti-C10orf56 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C10orf56 antibody: synthetic peptide directed towards the middle region of human C10orf56. Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: zinc finger CCHC-type containing 24
• Database Link:
  NP_699198
  Entrez Gene 219654 Human
  UniProt ID Q8N2G6
• Background: The exact function of C10orf56 remains unknown.
• Synonyms: C10orf56; Z3CXXC8
• Note: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 92%; Zebrafish: 92%