Antibodies

Jump to Filters
View as table Download
ZDHHC17 Goat Polyclonal Antibody
TA302507

USD 375.00

5 Days

Goat Polyclonal Antibody against HIP14 / ZDHHC17

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CYDQISGSGYQLV, from the C Terminus of the protein sequence according to NP_056151.1.
ZDHHC17 Rabbit Polyclonal Antibody
TA341967

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZDHHC17 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZDHHC17 antibody: synthetic peptide directed towards the middle region of human ZDHHC17. Synthetic peptide located within the following region: LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKP
ZDHHC17 Rabbit Polyclonal Antibody
TA341968

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZDHHC17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZDHHC17 antibody: synthetic peptide directed towards the middle region of human ZDHHC17. Synthetic peptide located within the following region: FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
ZDHHC17 Rabbit Polyclonal Antibody
TA383466

USD 275.00

3 Weeks

ZDHHC17 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZDHHC17 (NP_056151.2).
Modifications Unmodified