ZDHHC17 Rabbit Polyclonal Antibody

CAT#: TA341968

Rabbit Polyclonal Anti-ZDHHC17 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZDHHC17"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZDHHC17 antibody: synthetic peptide directed towards the middle region of human ZDHHC17. Synthetic peptide located within the following region: FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name zinc finger DHHC-type containing 17
Background ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved inThe sorting or targeting of critical proteins involved inThe initiating events of endocytosis atThe plasma membrane. It may be involved inThe NF-kappa-B signaling pathway and has transforming activity.
Synonyms HIP3; HIP14; HSPC294; HYPH
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.