ZDHHC17 Rabbit Polyclonal Antibody

CAT#: TA341968

Rabbit Polyclonal Anti-ZDHHC17 Antibody

Product Images

WB Suggested Anti-ZDHHC17 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate.ZDHHC17 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZDHHC17 antibody: synthetic peptide directed towards the middle region of human ZDHHC17. Synthetic peptide located within the following region: FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: zinc finger DHHC-type containing 17
• Database Link:
  NP_056151
  Entrez Gene 23390 Human
  UniProt ID Q8IUH5
• Background: ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved inThe sorting or targeting of critical proteins involved inThe initiating events of endocytosis atThe plasma membrane. It may be involved inThe NF-kappa-B signaling pathway and has transforming activity.
• Synonyms: HIP3; HIP14; HSPC294; HYPH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane