Rabbit Polyclonal Anti-ZDHHC20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZDHHC20 antibody is: synthetic peptide directed towards the N-terminal region of Human ZDHHC20. Synthetic peptide located within the following region: IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSAS |
Rabbit Polyclonal Anti-ZDHHC20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZDHHC20 antibody is: synthetic peptide directed towards the C-terminal region of Human ZDHHC20. Synthetic peptide located within the following region: PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI |
ZDHHC20 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZDHHC20 |
ZDHHC20 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZDHHC20 |
ZDHHC20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZDHHC20. |
Germany
Japan
United Kingdom
China