ZDHHC20 Rabbit Polyclonal Antibody

CAT#: TA330834

Rabbit Polyclonal Anti-ZDHHC20 Antibody

Product Images

Host: Rabbit; Target Name: ZDHHC20; Sample Tissue: THP-1 Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZDHHC20 antibody is: synthetic peptide directed towards the N-terminal region of Human ZDHHC20. Synthetic peptide located within the following region: IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: zinc finger DHHC-type containing 20
• Database Link:
  NP_694983
  Entrez Gene 253832 Human
  UniProt ID Q5W0Z9
• Background: The function of this protein remains unknown.
• Synonyms: 4933421L13Rik; DHHC-20
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 92%; Horse: 86%

Reference Data

• Protein Families: Transmembrane