Rabbit Polyclonal Anti-ZFP64 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the N terminal of human ZFP64. Synthetic peptide located within the following region: MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHK |
Rabbit Polyclonal Anti-ZFP64 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the C terminal of human ZFP64. Synthetic peptide located within the following region: SDGGQNIAVATTAPPVFSSSSQQELPKQTYSIIQGAAHPALLCPADSIPD |
Rabbit Polyclonal Anti-ZFP64 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFP64 antibody is: synthetic peptide directed towards the C-terminal region of Human ZFP64. Synthetic peptide located within the following region: SFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQPAT |
Rabbit Polyclonal Anti-ZFP64 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFP64 Antibody: synthetic peptide directed towards the N terminal of human ZFP64. Synthetic peptide located within the following region: YLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGM |
Rabbit Polyclonal Anti-ZFP64 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZFP64 Antibody: synthetic peptide directed towards the middle region of human ZFP64. Synthetic peptide located within the following region: AKKSFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIDPSKQ |
ZFP64 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZFP64 |
ZFP64 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZFP64 (NP_060667.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
