Germany
Japan
United Kingdom
China
ZFYVE1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 144-173 amino acids from the N-terminal region of human ZFYVE1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZFYVE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFYVE1 antibody: synthetic peptide directed towards the N terminal of human ZFYVE1. Synthetic peptide located within the following region: GVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGL |
Rabbit Polyclonal Anti-ZFYVE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFYVE1 antibody: synthetic peptide directed towards the C terminal of human ZFYVE1. Synthetic peptide located within the following region: VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP |
Carrier-free (BSA/glycerol-free) ZFYVE1 mouse monoclonal antibody,clone OTI1A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZFYVE1 mouse monoclonal antibody,clone OTI6C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZFYVE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZFYVE1 |
ZFYVE1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ZFYVE1 (NP_067083.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ZFYVE1 mouse monoclonal antibody,clone OTI1A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZFYVE1 mouse monoclonal antibody,clone OTI1A2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZFYVE1 mouse monoclonal antibody,clone OTI1A2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZFYVE1 mouse monoclonal antibody,clone OTI1A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZFYVE1 mouse monoclonal antibody,clone OTI6C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZFYVE1 mouse monoclonal antibody,clone OTI6C2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZFYVE1 mouse monoclonal antibody,clone OTI6C2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZFYVE1 mouse monoclonal antibody,clone OTI6C2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ZFYVE1