Antibodies

Jump to Filters
View as table Download
ZIC5 (651-663) Goat Polyclonal Antibody
AP22531PU-N

USD 440.00

2 Weeks

ZIC5 (651-663) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from the C-terminus of human ZIC5
ZIC5 Rabbit Polyclonal Antibody
TA334216

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZIC5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZIC5 antibody: synthetic peptide directed towards the N terminal of human ZIC5. Synthetic peptide located within the following region: MEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRAAVAH