Rabbit Polyclonal Anti-ZZZ3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZZZ3 antibody: synthetic peptide directed towards the middle region of human ZZZ3. Synthetic peptide located within the following region: VKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSDGPEGSSSRPQMIRG |
ZZZ3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZZZ3 |
ZZZ3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZZZ3 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
