ErbB 3 (ERBB3) mouse monoclonal antibody, clone DY-7G2, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
ErbB 3 (ERBB3) mouse monoclonal antibody, clone DY-7G2, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Rabbit polyclonal anti-HER3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HER3. |
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Rabbit monoclonal antibody against HER3/ErbB3 Phospho (pY1289) (EPR2325 ) (phospho-specific)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit polyclonal anti-HER3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3. |
ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 1250-1300 of Human ErbB-3. |
Rabbit Polyclonal ErbB3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
Modifications | Phospho-specific |
Annexin A2 (ANXA2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 111-160 of Human Annexin 2. |
Goat Polyclonal Antibody against ERBB3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HSRLFPKANAQRT, from the C Terminus of the protein sequence according to NP_001973.2. |
USD 530.00
2 Weeks
ErbB 3 (ERBB3) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 11A4, Biotin
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Goat Polyclonal Antibody against Calretinin
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Rabbit Polyclonal Anti-ANXA2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI1A6
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI1F1
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI3C1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI10D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ANXA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANXA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody,clone OTI1A6
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1A6, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1A6, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody,clone OTI1A6
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody,clone OTI1F1
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1F1, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1F1, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody,clone OTI1F1
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI3C1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI3C1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI3C1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |