Annexin A2 (ANXA2) Rabbit Polyclonal Antibody

CAT#: TA341656

Rabbit Polyclonal Anti-ANXA2 Antibody

Product Images

WB Suggested Anti-ANXA2 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

• 

  Lanes: ; Lane 1: 20ug mouse GL261 cell lysate; Lane 2: 20ug mouse astrocyte cell lysate; Primary Antibody Dilution: ; 1:250; Secondary Antibody: ; Anti-rabbit-HRP; Secondary Antibody Dilution: ; 1:500; Gene Name: ; ANXA2; Submitted by: ; Anonymous;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: annexin A2
• Database Link:
  NP_004030
  Entrez Gene 12306 MouseEntrez Gene 302 Human
  UniProt ID P07355
• Background: This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in signal transduction pathways.This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption.This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: ANX2; ANX2L4; CAL1H; HEL-S-270; LIP2; LPC2; LPC2D; P36; PAP-IV
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Stem cell - Pluripotency